DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG8870

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:359 Identity:89/359 - (24%)
Similarity:135/359 - (37%) Gaps:117/359 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IFSFLLFL-LLLLPILD-AGDPIGSHFV------RRRAKRLSSPYFDKEKTLVLAKYVVSIR--- 65
            |.||||.| ::|:|..: ||....:..|      |.||...||           .|.::.:|   
  Fly     6 IGSFLLMLQIILVPYSNGAGCQFDTECVNLDKCPRTRAVMNSS-----------RKNIIGLRRCG 59

  Fly    66 ---------------------SRRPHK---------------LFGDNH--------FCGGVIISR 86
                                 .|:|.|               |:|:.:        .|||.:|:.
  Fly    60 TNKVCCPKWETYLPHDTCGQSRRKPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINN 124

  Fly    87 TYILTSAHCA----MD------------KRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIF 135
            .|:||:|||.    ||            .....:..|.:|      |..:....|.:.:||.:|.
  Fly   125 WYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIV------NGRRQYAPLYMEIEVDQII 183

  Fly   136 VPDKFTVFN--TNNIALMMLAKKLPLD-NPLVGVINLPTADPEPG--LNYTVLGWGRIFKGGPLA 195
            ..::|....  .|:|||:.|  |.|:. ...:..|.||.|.....  ..:...||..:.:|  :|
  Fly   184 THEQFNRGRRLINDIALVRL--KFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQG--IA 244

  Fly   196 SDIL--HIDVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVF------ 252
            |::|  ....|..| |:|:..........:|||.|:.. |.:|  ||:|.||:  |||.      
  Fly   245 SEVLLRSFIAERHP-DVCKSNYDFNLGSQICAGGLDGN-DTSP--GDSGGPLM--ETVIRGKVTL 303

  Fly   253 ----GVVSY-RVGCGSKTL-PSIYTNVYMHMDWI 280
                |::|| :..|..||. |:.||......:||
  Fly   304 TYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 72/303 (24%)
Tryp_SPc 60..280 CDD:214473 70/301 (23%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 68/261 (26%)
Tryp_SPc 93..337 CDD:214473 66/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437238
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.