DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG14088

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:227 Identity:60/227 - (26%)
Similarity:88/227 - (38%) Gaps:45/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDKFT-VFN 144
            |.:|...:|||..||. |...:: |:|:     |...|:.|.  |:.:..|...|....|. ...
  Fly    60 GTLIHERFILTDVHCG-DSIGVI-RARL-----GEYGRIGSE--LAEDHIVAAFFSNANFNPETQ 115

  Fly   145 TNNIALMMLAKKLPLDNPLVGVINL------PTADPEPGLNYTVLGWGRIFKGGPLASDILHIDV 203
            .||:.||.|.:.:.....::.|..|      ..||.....|.|.  |....|...|.|.    .|
  Fly   116 ANNMGLMKLLRTVVYKEHIIPVCILMDSRMQTFADELDYFNGTT--WKNSDKSPMLRSK----TV 174

  Fly   204 ELLPRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIF-------NETV-FGVV-SYRV 259
            ..:|: .|.|..|    ...|||:    .|.:.|...:|:.|..       |.|| ||:. |..|
  Fly   175 IRMPQ-ACGKLDH----GQFCAGH----KDLDSCDEPSGAALTREIDYIGPNRTVLFGIANSVEV 230

  Fly   260 GC-GSKTLPSIYTNVYMHMDWINGIMNNNEAN 290
            .| .|:|    ||:|.....||:.::.::..|
  Fly   231 KCSNSRT----YTDVVQLHQWISMVIYSSNTN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 59/218 (27%)
Tryp_SPc 60..280 CDD:214473 57/215 (27%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 59/218 (27%)
Tryp_SPc 42..248 CDD:214473 57/215 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.