DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG7542

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:246 Identity:67/246 - (27%)
Similarity:116/246 - (47%) Gaps:54/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 FGD-NHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTN-RLKSRKGLS-LNMEVKKI 134
            ||: :.:|||.:||..:|:|:||| ||..:.|      .|..|..| ..:|.:|.. :.:|...|
  Fly    48 FGNWSTWCGGTLISHYWIITAAHC-MDGAESV------TVYLGAINIGDESEEGQERIMVEKSGI 105

  Fly   135 FVPDKF---TVFNTNNIALMML-----------AKKLPLDNPLVGVINLPTADPEPGLNYTVLGW 185
            .|...:   ||  .|:|:|:.|           |..||  ..|.|  ..||.:   .:.....||
  Fly   106 IVHSNYMASTV--VNDISLIRLPAFVGFTDRIRAASLP--RRLNG--QFPTYE---SIRAFASGW 161

  Fly   186 GRIFKGGPLASDIL-HIDVELLPRDICEKKVH---IFKEEMMCAGNLNNTMDENPCAGDTGSPLI 246
            ||........|.:| ::::.::|..:|  :::   ...|:|:|   ::.|..::.|.||:|.||:
  Fly   162 GRESDASDSVSPVLRYVEMPIMPHSLC--RMYWSGAVSEKMIC---MSTTSGKSTCHGDSGGPLV 221

  Fly   247 FNETVFGVVSYRVGCGS--------KTLPSIYTNVYMHMDWI-NGIMNNNE 288
            :.:   |..||.:|..|        ...|:::|.:..::||| |.|:.:|:
  Fly   222 YKQ---GNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWILNHIIAHNK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 65/239 (27%)
Tryp_SPc 60..280 CDD:214473 62/235 (26%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 64/238 (27%)
Tryp_SPc 27..260 CDD:214473 62/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436879
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.