DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and Jon74E

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:298 Identity:81/298 - (27%)
Similarity:127/298 - (42%) Gaps:59/298 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KIFSFLLFLLLL-----LPILDAGDPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPH 70
            :|.:.|:|||:|     :..||.|..||.........|.:.           ..|.|.:....|:
  Fly     2 QISTILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQ-----------FPYQVGLSIEEPN 55

  Fly    71 KLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGL-SLNMEVKKI 134
            .::   .:||..:||..|:||:|||       |.::..:....|...||..|:.: |.|.||.  
  Fly    56 DMY---CWCGASLISDRYLLTAAHC-------VEKAVAITYYLGGVLRLAPRQLIRSTNPEVH-- 108

  Fly   135 FVPDKFTVFNTNNIALMMLAKKLPLDNPL---VGVINLP-------TADPEPGLNYTVLGWGRIF 189
            ..||.......|:|||:    :||.|..|   :..|.||       :.|..|.:   ..||||:.
  Fly   109 LHPDWNCQSLENDIALV----RLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAI---ASGWGRMN 166

  Fly   190 KGGPLASDILHIDVELL-PRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETV-- 251
            ......||.|......: ..:.||......|...:|   ::.|..::.|.||:|.||::::.|  
  Fly   167 DESTAISDNLRYVYRFVESNEDCEYSYANIKPTNIC---MDTTGGKSTCTGDSGGPLVYSDPVQN 228

  Fly   252 ----FGVVSY--RVGCGSKTLPSIYTNVYMHMDWINGI 283
                .||.||  :.|| :|..||::|.:..::|||..:
  Fly   229 ADILIGVTSYGKKSGC-TKGYPSVFTRITAYLDWIGEV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 69/242 (29%)
Tryp_SPc 60..280 CDD:214473 67/239 (28%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 68/264 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.