DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG11529

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:283 Identity:71/283 - (25%)
Similarity:129/283 - (45%) Gaps:44/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KIFSFLLFLLLLLPILDAGDPIGSHFV-RRRAKRLSS-PYFDKEKTLVLAKYVVSIRSRRPHKLF 73
            |..:.||.|.:::.::....|..|:.| :.:..|:.. ||    :.:::.|           :|:
  Fly     4 KSIAHLLGLAVIMLMMWKPTPTDSYAVGQSKYGRIEKFPY----QVMLIGK-----------QLW 53

  Fly    74 GDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPD 138
            .....|||.::.:.:|||:.||.|.   :.|..    |..||.:...:.....|.:...|..|.:
  Fly    54 RKRILCGGTLLDKRWILTAGHCTMG---VTHYD----VYLGTKSVEDTEVSGGLVLRSNKFIVHE 111

  Fly   139 KFTVFN-TNNIALMMLAKKLPLD---NPLVGVINLPTA---DPEPGLNYTVLGWGRIFKGGPLAS 196
            :|.... .|:|||:    |||.|   .|.:...:||:.   |...|::....|||.:.:  ...|
  Fly   112 RFNPETAANDIALV----KLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVASGWGAMVE--MTNS 170

  Fly   197 DIL-HIDVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNET--VFGVVSYR 258
            |.: :.:::::....|.::..:....::||..|.   ||..|.||:|.||:..:|  |.|:.|:.
  Fly   171 DSMQYTELKVISNAECAQEYDVVTSGVICAKGLK---DETVCTGDSGGPLVLKDTQIVVGITSFG 232

  Fly   259 VGCGSKT-LPSIYTNVYMHMDWI 280
            ...|.:| :|..:|.|..::|||
  Fly   233 PADGCETNIPGGFTRVTHYLDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 60/232 (26%)
Tryp_SPc 60..280 CDD:214473 58/230 (25%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 64/250 (26%)
Tryp_SPc 37..255 CDD:214473 62/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.