DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG18179

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:251 Identity:61/251 - (24%)
Similarity:95/251 - (37%) Gaps:69/251 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 AKYVVSIRSRRPHKLFGDNHFC--GGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLK 120
            |.|:|.:..|..    |.|...  .|.||:..:|||:|||.                  ||:.::
  Fly    51 APYIVGLLIRTD----GSNSAAVGAGTIIASDWILTAAHCL------------------TTDYVE 93

  Fly   121 SRKGL------SLNMEVKKIFVPDKFTVFNTN-------NIALMMLAKKLPLDNPLVGVINLPTA 172
            ...|.      :....|::    |.| :.:.|       :|.|        :..|.||..:|...
  Fly    94 IHYGSNWGWNGAFRQSVRR----DNF-ISHPNWPAEGGRDIGL--------IRTPSVGFTDLINK 145

  Fly   173 DPEPGLN----------YTVLGWGRIFKGGPLASDILHIDVELLPRDICEKKVHIFKEEMMCAGN 227
            ...|..:          ....|||.: ..|.||..:..:||:::....||:.........||.  
  Fly   146 VALPSFSEESDRFVDTWCVACGWGGM-DNGNLADWLQCMDVQIISNSECEQSYGTVASTDMCT-- 207

  Fly   228 LNNTMDENPCAGDTGSPLIF--NETVFGVVSY-RVGCGSKTLPSIYTNVYMHMDWI 280
             ..|..::.|.||:|.||:.  |..:.||::: .|.|.|.  ||.||.|..::.||
  Fly   208 -RRTDGKSSCGGDSGGPLVTHDNARLVGVITFGSVDCHSG--PSGYTRVTDYLGWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 60/249 (24%)
Tryp_SPc 60..280 CDD:214473 58/247 (23%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 59/249 (24%)
Tryp_SPc 40..263 CDD:238113 61/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436795
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.