DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG8329

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:293 Identity:68/293 - (23%)
Similarity:116/293 - (39%) Gaps:63/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VSRKIFSFLLFLLLLLPILDAGDPIGSHFVRRR-AKRLSSPYFDKEKTLVL---------AKYVV 62
            :|:|:...|||:.          .:.:|..|.| |.....|     |.:::         |.|.|
  Fly     1 MSKKLVLLLLFVA----------TVCAHRNRNRTAHHGGGP-----KDIIVNGYPAYEGKAPYAV 50

  Fly    63 SIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSL 127
            .:|       ..:....||.:|...::||:|||.......:|..         :||..:.: |..
  Fly    51 GLR-------MNNGAVGGGSVIGNNWVLTAAHCLTTDSVTIHYG---------SNRAWNGQ-LQH 98

  Fly   128 NMEVKKIFVPDKFTVFNTNNIALMMLAKKLPLDN--PLVGVINLPTADPEPGLNY-----TVLGW 185
            .:.....|....:.....::|.|:    :.|..:  .|:..::||... :.|..:     ...||
  Fly    99 TVNKNNFFRHPGYPNSAGHDIGLI----RTPYVSFTNLINKVSLPKFS-QKGERFENWWCVACGW 158

  Fly   186 GRIFKGGPLASDILHIDVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIF--N 248
            |.:..|| ||..:..:||:::....|.:.........||.   ..|..::.|.||:|..|:.  |
  Fly   159 GGMANGG-LADWLQCMDVQVISNGECARSYGSVASTDMCT---RATDGKSVCGGDSGGALVTHDN 219

  Fly   249 ETVFGVVSY-RVGCGSKTLPSIYTNVYMHMDWI 280
            ....||::: .:||  |:.||.||.|..|:|||
  Fly   220 PIQVGVITFASIGC--KSGPSGYTRVSDHLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 56/231 (24%)
Tryp_SPc 60..280 CDD:214473 54/229 (24%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 57/244 (23%)
Tryp_SPc 35..250 CDD:214473 55/242 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.