DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG4477

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:310 Identity:117/310 - (37%)
Similarity:187/310 - (60%) Gaps:14/310 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FLLFLLLLLPILDA-GD-PIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKLFGDNH 77
            |:|.::...|:.:. || |..:.....|.||||...|| |.::.|:.|.||:|||...|.|||||
  Fly     7 FVLLVISFFPLYNCLGDSPRNAFSSLNRVKRLSDGDFD-EDSIALSNYCVSLRSRSAEKFFGDNH 70

  Fly    78 FCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDKFTV 142
            ||.|||::..:::|||||.::||:::..||||::||||.||||.....:....|..|::||.||:
  Fly    71 FCSGVILAPMFVMTSAHCLINKRRVLISSRVLLIVAGTLNRLKYIPNRTFVTPVTHIWLPDSFTM 135

  Fly   143 FNTNNIALMMLAKKLPLDNPLVGVINLPTADPEPGLNYTVLGWGRIFKGGPLASDILHIDVELLP 207
            .|..:..|:.:....|.:|..:.:..||...|.|||...|:||||::|||||||.:|:|||:::.
  Fly   136 RNKQDFGLLKVKNPFPRNNEHISIARLPVHPPLPGLKCKVMGWGRMYKGGPLASYMLYIDVQVID 200

  Fly   208 RDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFGVVSYRVGCGSKTLPSIYTN 272
            .:.|.|.:.:...|.:||.:.::...:.||.||.|:|::.|.||:|:|:...|||...|||:|||
  Fly   201 SEACAKWLRVPSVEHVCAVDSDDLTAQQPCGGDWGAPMLHNGTVYGIVTILAGCGVSHLPSLYTN 265

  Fly   273 VYMHMDWINGIMNNNEANRLCYSPNYLFTTIGIIIGNKILKSWGFYLITI 322
            |:.:.:||:..:.::..:.|...|.:.:.:|.:|           |::|:
  Fly   266 VHSNANWIHEKIISSAGSILLVPPLFRYLSIALI-----------YVVTL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 96/222 (43%)
Tryp_SPc 60..280 CDD:214473 94/219 (43%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 95/220 (43%)
Tryp_SPc 55..273 CDD:214473 93/217 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C5SZ
Homologene 1 1.000 - - H117632
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008551
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.