DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:272 Identity:62/272 - (22%)
Similarity:110/272 - (40%) Gaps:53/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PILDAGDPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKLFGDNHFCGGVIISRTY 88
            |:.....|:|...:..|. .:..|.::.:     ..|:|.:...:.    |...:|||.||..|:
  Fly    21 PVFWKDVPVGKASIEGRI-TMGYPAYEGK-----VPYIVGLGFSKN----GGGTWCGGSIIGNTW 75

  Fly    89 ILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSR----KGLSLNMEVKKIFVPDKFTVFNTNNIA 149
            ::|:.||......:       .:..|...||:::    .|.|            .|....:.:|:
  Fly    76 VMTAKHCTDGMESV-------TIYYGALWRLQAQYTHWVGRS------------DFIEHGSGDIS 121

  Fly   150 LMMLAKKLPLDN--PLVGVINLPTADPEPGLNY-----TVLGWGRIFKGGPLASDILHIDVELLP 207
            |:    :.|..:  .||..:.||..|.... ||     .|.|||:....|.::..:..:||::..
  Fly   122 LI----RTPHVDFWSLVNKVELPRYDDRYN-NYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGE 181

  Fly   208 RDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNE--TVFGVVSY--RVGCGSKTLPS 268
            ..:||.....|..:::|.....|   :..|:||:|.||:.::  ...|:||:  ..||.|.. |.
  Fly   182 NSVCENYYGSFSGDLICIPTPEN---KGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNG-PK 242

  Fly   269 IYTNVYMHMDWI 280
            ....|..::|||
  Fly   243 GMVRVTSYLDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 57/236 (24%)
Tryp_SPc 60..280 CDD:214473 55/234 (24%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 57/254 (22%)
Tryp_SPc 41..257 CDD:238113 58/251 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436747
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.