DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and Jon65Ai

DIOPT Version :10

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_648015.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:60 Identity:16/60 - (26%)
Similarity:28/60 - (46%) Gaps:9/60 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TVW-DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDE--LRDAV 120
            |.| |...:.|..|.::....||.|      |..:|...:..:||.:..:||:  ::||:
  Fly   637 TYWLDYCIELKDLPQYQAVASNTSG------STPKDLFEDVTEELEKQYHEDKSYVKDAM 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..280 CDD:214473 16/60 (27%)
Jon65AiNP_648015.1 Tryp_SPc 37..254 CDD:214473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.