DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:220 Identity:49/220 - (22%)
Similarity:96/220 - (43%) Gaps:37/220 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 FCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDKFTV 142
            :|||.:|..|::||:|||....:.:       .|..|.|.|..:.  ::..:....|.:...:..
  Fly    66 WCGGSLIGSTWVLTAAHCTDGVQSV-------TVYLGATVRTSAE--ITHTVSSSDIIIHSGWNS 121

  Fly   143 FN-TNNIALMMLAKKLPL--DNPLVGVINLPTADPEPGLNYTVL--------GWGRIF-KGGPLA 195
            .| .|:|:|:    |:|.  .:..:..:.||:...    :|:..        ||||.. ....:|
  Fly   122 ANLRNDISLI----KIPATSSSSRISAVKLPSISN----SYSTFVGDVAVASGWGRTSDTSSGVA 178

  Fly   196 SDILHIDVELLPRDICEKK--VHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNET--VFGVVS 256
            :::.::|:.::....|.:.  ..:..:..:|..   .|..::.|.||:|.||:...:  ..|:.|
  Fly   179 TNLQYVDLTVITNTKCAQTYGTSVVTDSTLCVA---TTDAKSTCNGDSGGPLVLKSSSEQIGLTS 240

  Fly   257 YRVGCG-SKTLPSIYTNVYMHMDWI 280
            :....| .|..|:.:|.|..::|||
  Fly   241 FGASAGCEKGYPAAFTRVTSYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 49/220 (22%)
Tryp_SPc 60..280 CDD:214473 47/218 (22%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 47/218 (22%)
Tryp_SPc 38..268 CDD:238113 49/220 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.