DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and yip7

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:219 Identity:46/219 - (21%)
Similarity:86/219 - (39%) Gaps:37/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 FCGGVIISRTYILTSAHCAMDKRKI-------VHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIF 135
            :|||.||...::||:|||......:       |..|.....|..::...:....|:|.       
  Fly    67 WCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALT------- 124

  Fly   136 VPDKFTVFNTNNIALMMLAKKLPLDNPLVGVINLPTADPE----PGLNYTVLGWGRIF-KGGPLA 195
            :.:..::..|::::......|          |:||.....    .|......|||... :...::
  Fly   125 IRNDISLIQTSSVSFSATVNK----------ISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVS 179

  Fly   196 SDILHIDVELLPRDICEKKVH--IFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFGVVSY- 257
            .|:.::|:.::....|::...  |....::|....|..   :.|.||:|.||..:..:.|..|: 
  Fly   180 RDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNKA---STCQGDSGGPLALDGVLIGATSFG 241

  Fly   258 -RVGCGSKTLPSIYTNVYMHMDWI 280
             ..||.|.. |:.:|.:..:.|||
  Fly   242 SADGCESGA-PAAFTRITYYRDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 46/219 (21%)
Tryp_SPc 60..280 CDD:214473 44/217 (20%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 44/217 (20%)
Tryp_SPc 40..267 CDD:238113 46/219 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.