DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG13527

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:266 Identity:122/266 - (45%)
Similarity:182/266 - (68%) Gaps:9/266 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FLLFLLLLLPILDAGDPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKLFGDNHFC 79
            ::..|:.::.||.     |:|    |.||||||.|..::||.|||||||||||.|:|.|||||:|
  Fly     7 YVAILITVMVILS-----GAH----RMKRLSSPKFHGDETLELAKYVVSIRSRTPNKYFGDNHYC 62

  Fly    80 GGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDKFTVFN 144
            ||.::|..:::|:|||.|.:.||::::|.|:||||:.:||:...|.|:...|..::||..||:.|
  Fly    63 GGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFTMHN 127

  Fly   145 TNNIALMMLAKKLPLDNPLVGVINLPTADPEPGLNYTVLGWGRIFKGGPLASDILHIDVELLPRD 209
            |.|:|||.|.:|:|.::|.:|.::||...|:.|:.:|||||||::.|||||..|..:||.|:...
  Fly   128 TFNMALMKLQEKMPSNDPRIGFLHLPKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDVVLMDNA 192

  Fly   210 ICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFGVVSYRVGCGSKTLPSIYTNVY 274
            :|:.....:.:.||||||.|.|:|..||:||.||||:..:.|.|:|:|.:|||...:||:||:|:
  Fly   193 VCKTYFRHYGDGMMCAGNNNWTIDAEPCSGDIGSPLLSGKVVVGIVAYPIGCGCTNIPSVYTDVF 257

  Fly   275 MHMDWI 280
            ..:.||
  Fly   258 SGLRWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 104/221 (47%)
Tryp_SPc 60..280 CDD:214473 102/219 (47%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 104/221 (47%)
Tryp_SPc 43..263 CDD:214473 102/219 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C5SZ
Homologene 1 1.000 - - H117632
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008551
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.