DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG30283

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:253 Identity:70/253 - (27%)
Similarity:98/253 - (38%) Gaps:93/253 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LFGDNHF-CGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKG-LSLNMEVKKI 134
            :.|:..| |||.:|:..::||||||.                  ....||.|.| |....|.:|.
  Fly    60 VMGEGGFHCGGTLITNRFVLTSAHCI------------------ANGELKVRLGVLEREAEAQKF 106

  Fly   135 FVPDKFT----VFNTNNIALMMLAKKLPL-DN---------PLVGVINLPTADPEPGLNYTVLGW 185
            .|...|.    .|:.:::||:.|||::.. ||         |||..|:      |..:.:...||
  Fly   107 AVDAMFVHTDYYFDQHDLALLRLAKRVHYSDNISPICLLLDPLVKNID------EHIVKFRTYGW 165

  Fly   186 G--------RIFKGGPLASDILHIDVELLPRDICEKKV--------HIFKEEMMCAGNLNNTMDE 234
            |        |:.:...|.:  ||       |..|.|:.        ||      ||.:.|    .
  Fly   166 GKTESRSSSRMLQKTSLFN--LH-------RSECAKQYPHQQINRNHI------CAESAN----A 211

  Fly   235 NPCAGDTGSPL-----------IFNETVFGVVSY-RVGCGSKTLPSIYTNVYMHMDWI 280
            |.|.||:|.||           :|.   |||.|: ...|...|   ::|||..|:|||
  Fly   212 NTCNGDSGGPLTAIVTYDHVQMVFQ---FGVTSFGHADCSKAT---VFTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 70/253 (28%)
Tryp_SPc 60..280 CDD:214473 68/251 (27%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 68/251 (27%)
Tryp_SPc 43..266 CDD:238113 70/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.