DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG10764

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:272 Identity:71/272 - (26%)
Similarity:113/272 - (41%) Gaps:73/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LFGDNHF-CGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTN-RLKSRKGLSLNMEVKKI 134
            :|..:.| |||.||...::|::|||.:       |...|.|..|..| ...:.....:|:.|...
  Fly    55 IFNSSDFQCGGTIIHMRFVLSAAHCLV-------RGYDLYVRLGARNINEPAAVHTVINVFVHHD 112

  Fly   135 FVPDKFTVFNTNNIALMMLAKKLP-----------LDNPLVGVINLPTADPEPGLNYTVLGWGRI 188
            |:..::    .|:|.|:.|::.:.           ||..|.|.:       |....:..||||. 
  Fly   113 FIASEY----RNDIGLLQLSESIVYTVRVQPICIFLDPALKGSV-------EKLKTFRALGWGN- 165

  Fly   189 FKGGPLASDILHIDVELLPRDICEKKVHI-FKEEMMCAGNLNNTMDENPCAGDTGSPLIFN---- 248
             :.|.|:..:..|.:..|.|:.|::|::. .....:|||..|.    :.|.||:|.||..|    
  Fly   166 -RNGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQICAGTKNG----DTCRGDSGGPLSTNILFP 225

  Fly   249 -----ETVFGVVSYR----VGCGSKTLPSIYTNVYMHMDWINGIMNNNEANRLCYSPNYLFTTIG 304
                 |...|:||:.    .|.|      :||:|..::|||:..:..|:     |.|      ||
  Fly   226 SNKSYEVQLGIVSFGDPECRGVG------VYTDVTSYVDWISSTIARND-----YLP------IG 273

  Fly   305 -----IIIGNKI 311
                 |.:||.|
  Fly   274 VSGGDIAMGNPI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 62/237 (26%)
Tryp_SPc 60..280 CDD:214473 60/234 (26%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 60/234 (26%)
Tryp_SPc 38..263 CDD:238113 62/237 (26%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.