DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and scaf

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:241 Identity:54/241 - (22%)
Similarity:88/241 - (36%) Gaps:73/241 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 CGGVIISRTYILTSAHC-----AMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNME-VKKIFV- 136
            |||.||...::|:||.|     ..|.|          |.||......:.:.|...:. ||.:.| 
  Fly   450 CGGAIIGDQFVLSSASCVNGLPVTDIR----------VKAGEWELGSTNEPLPFQLTGVKTVDVH 504

  Fly   137 PDKFTVFNTNNIALMMLAKKLPLDNPLVGVINLPTADPEPGLNYTVLGWGR----IFKGGPLASD 197
            ||.....|::::|::.|.::|...:. :..|.:...||:........|||:    |.:.|.|   
  Fly   505 PDYDPSTNSHDLAIIRLERRLEFASH-IQPICISDEDPKDSEQCFTSGWGKQALSIHEEGAL--- 565

  Fly   198 ILHIDVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFGVVSYRVG-- 260
             :|: .:.||:...|                        |:.|:.|  :.:.|.|....:.||  
  Fly   566 -MHV-TDTLPQARSE------------------------CSADSSS--VCSATKFDSCQFDVGSA 602

  Fly   261 --CGSKT---LPSIYTN------------VYMHMDWIN-GIMNNNE 288
              |||.:   |..|:..            ....:.||| ....||:
  Fly   603 LACGSGSSVRLKGIFAGENSCGEGQTVRFAKPDIKWINTAFAENNK 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 52/234 (22%)
Tryp_SPc 60..280 CDD:214473 49/230 (21%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 48/207 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.