DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and psh

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:256 Identity:63/256 - (24%)
Similarity:110/256 - (42%) Gaps:63/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PHK------LFGDNHFCGGVIISRTYILTSAHC--------------AMDKRKIVHRSRVLVVVA 113
            ||.      .||.:..|||.:|:..::||:|||              |::.....|..:.:|:  
  Fly   156 PHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDHSYQDIVI-- 218

  Fly   114 GTTNRLKSRKGLSLNMEVKKIFVPDKFTVFNTNNIALMMLAKK-LPLDNPLVGVINLPTADPEPG 177
                         .::::...:|.:|:     |:||::.|.:. :..||.....::....||...
  Fly   219 -------------RSVKIHPQYVGNKY-----NDIAILELERDVVETDNIRPACLHTDATDPPSN 265

  Fly   178 LNYTVLGWGRIFKGGPLASDI-LHIDVELLPRDICE-------KKVHIFK----EEMMCAGNLNN 230
            ..:.|.|||.:.......|.| |...:||:|.|.|.       ..:.:.|    :.::||  ::.
  Fly   266 SKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCA--IDQ 328

  Fly   231 TMDENPCAGDTGSPLIFN-------ETVFGVVSYRVGCGSKTLPSIYTNVYMHMDWINGIM 284
            .:..:.|.||:|.|||..       .|:.||:|...||.:.| |.:||.|..::|:|.||:
  Fly   329 KLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVT-PGLYTRVSSYLDFIEGIV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 61/253 (24%)
Tryp_SPc 60..280 CDD:214473 60/250 (24%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 60/250 (24%)
Tryp_SPc 144..387 CDD:238113 61/253 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437639
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.