DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and Hayan

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:283 Identity:77/283 - (27%)
Similarity:110/283 - (38%) Gaps:60/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPH------KLFGDNHF-CGGVIISRTYILTSAH 94
            :|...|.|:....|.|:.         .|...||      ..||...| |||.:|:..::||:||
  Fly   374 IRSGGKPLTVHILDGERV---------DRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAH 429

  Fly    95 CAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFV---PDKFTVFNTNNIALMML--- 153
            |...     ..|....|..|..|......|.   .::..|.|   ||........:||::.|   
  Fly   430 CVNS-----DDSTPSFVRLGALNIENPEPGY---QDINVIDVQIHPDYSGSSKYYDIAILQLAED 486

  Fly   154 AKKLPLDNPLVGVINLPTADPEPGLNYTVLGWGRIFKGGPLASDI-LHIDVELLPRDICEKKVHI 217
            ||:..:..|  ..:....:||.....|.|.|||.:.......|.| |...::|:|.|.|...   
  Fly   487 AKESDVIRP--ACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNAS--- 546

  Fly   218 FKEE--------------MMCAGNLNNTMDENPCAGDTGSPLIF-------NETVFGVVSYRVGC 261
            |.|:              .:||.:.|...|  .|.||:|.|||.       ..::.||:|...||
  Fly   547 FAEQPSANRTLRRGVIASQLCAADKNQRKD--ACQGDSGGPLILEIDDVDGTYSIVGVISSGFGC 609

  Fly   262 GSKTLPSIYTNVYMHMDWINGIM 284
            .:|| |.:||.|...:|:|.||:
  Fly   610 ATKT-PGLYTRVSSFLDYIEGIV 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 70/257 (27%)
Tryp_SPc 60..280 CDD:214473 69/254 (27%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 71/267 (27%)
Tryp_SPc 385..630 CDD:238113 72/269 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.