DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and sphe

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:210 Identity:64/210 - (30%)
Similarity:104/210 - (49%) Gaps:15/210 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DN-HFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPD 138
            || |.|||.|:|:|.|||:|||.....|::..|| |....|:||:...  |..:|:|...:. ||
  Fly    46 DNAHVCGGSILSQTKILTTAHCVHRDGKLIDASR-LACRVGSTNQYAG--GKIVNVESVAVH-PD 106

  Fly   139 KFTVFNTNNIALMMLAKKLPLDNPLVGVINLPTAD--PEPGLNYTVLGWGRIFKGGPLASDILHI 201
            .:.:  .||:|::.|:.:|...:.:..:..:.:.:  |..|....|.||||. ..|..:..|..|
  Fly   107 YYNL--NNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIVAGWGRT-SDGTNSYKIRQI 168

  Fly   202 DVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFGVVSYRVG-CGSKT 265
            .:::.|...|........|:..|   |.:.:.|..|.||.|...|:..|:.|:.::.|| |||: 
  Fly   169 SLKVAPEATCLDAYSDHDEQSFC---LAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSR- 229

  Fly   266 LPSIYTNVYMHMDWI 280
            .|.::..:..:.|||
  Fly   230 YPDVFVRLSSYADWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 64/210 (30%)
Tryp_SPc 60..280 CDD:214473 62/208 (30%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 64/210 (30%)
Tryp_SPc 42..244 CDD:214473 62/208 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436915
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.