DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG31220

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:240 Identity:67/240 - (27%)
Similarity:105/240 - (43%) Gaps:59/240 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 CGGVIISRTYILTSAHCAMDKRKIVHR---------------SRVLVVVAGTTNRLKSRKGLSLN 128
            |||.:|:..|:||:|||..|....:.|               ||...:|...|:         |:
  Fly   139 CGGSLINTRYVLTAAHCVTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTH---------LD 194

  Fly   129 MEVKKI-----FVPDKFTVFNTNNIALMMLAKKLPLDNPL----VGVINLPTADPEPGLNYTVLG 184
            ::|:.|     :.|..:|.  .|:|||:.|  |.|:...:    :.|::.|.:..:  ....|.|
  Fly   195 IDVESITSHNDYDPANYTF--RNDIALVRL--KEPVRYTMAYYPICVLDYPRSLMK--FKMYVAG 253

  Fly   185 WGR--IFKGGPLASDIL-HIDVELLPRDICEKKV---HIFKEEMMCAGNLNNTMDENPCAGDTGS 243
            ||:  :|..|   |.:| |..|::...:.|.:|.   |......:|||.|:|   ...|.||:||
  Fly   254 WGKTGMFDTG---SKVLKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGLDN---RGTCDGDSGS 312

  Fly   244 PLIFN-----ETV---FGVVSYRVGCGSKTLPSIYTNVYMHMDWI 280
            ||:..     ||:   .|:.||...||:...||::|.......||
  Fly   313 PLMGTSGRSYETITFLAGITSYGGPCGTIGWPSVFTRTAKFYKWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 67/240 (28%)
Tryp_SPc 60..280 CDD:214473 65/238 (27%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 65/238 (27%)
Tryp_SPc 104..360 CDD:238113 67/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437202
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.