DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG8952

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:241 Identity:62/241 - (25%)
Similarity:98/241 - (40%) Gaps:68/241 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFV-PD 138
            |:..|||.|||.|::||:|||......|       .::.||.:...:.   :|||....|.: ||
  Fly    61 DDLLCGGSIISDTWVLTAAHCTNGLSSI-------FLMFGTVDLFNAN---ALNMTSNNIIIHPD 115

  Fly   139 KFTVFNTNNIALMMLAKKLPLDN-----PLVGVINLPTADPEPGLNY-----TVLGWGRIFKGGP 193
            .....| |:::|:.|.:.|....     .|||...       ..::|     |:.|:|       
  Fly   116 YNDKLN-NDVSLIQLPEPLTFSANIQAIQLVGQYG-------DSIDYVGSVATIAGFG------- 165

  Fly   194 LASD--------ILHIDVELLPRDICEK--KVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLI-F 247
            ...|        :|:..||::....|..  ..::..:..|||...:.: |.:.|.||:|.||| :
  Fly   166 YTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGS-DMSTCTGDSGGPLILY 229

  Fly   248 NETV-----FGVVS--------YRVGCGSKTLPSIYTNVYMHMDWI 280
            |:|:     .|:.|        ||       |||.|..|...:.:|
  Fly   230 NKTIQQWQQIGINSFVAEDQCTYR-------LPSGYARVSSFLGFI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 62/241 (26%)
Tryp_SPc 60..280 CDD:214473 61/239 (26%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 61/239 (26%)
Tryp_SPc 38..271 CDD:238113 62/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436909
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.