DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG31269

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:260 Identity:70/260 - (26%)
Similarity:118/260 - (45%) Gaps:50/260 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FDKEKTLV--------LAKYVVSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHR 105
            |.|::.::        .|.|.:|::.      ....|.|||.||:.|::||:|||       |..
  Fly    32 FYKDQRIIGGQAAEDGFAPYQISLQG------ISGAHSCGGAIINETFVLTAAHC-------VEN 83

  Fly   106 SRV--LVVVAGTTNRLKSRKGLSLNMEVKKIFV------PDKFTVFNTNNIALMMLAKKLPLD-- 160
            :.:  ||||.| ||:.....|   ...:|.|.:      |:..     |:|||:.|.:.:..|  
  Fly    84 AFIPWLVVVTG-TNKYNQPGG---RYFLKAIHIHCNYDNPEMH-----NDIALLELVEPIAWDER 139

  Fly   161 -NPLVGVINLPTADPEPGLNYTVLGWGRIFKGGPLASDILHIDVELLPRDICEKKVHIFKEEMMC 224
             .|    |.||....:||....:.|||.....|....|:..:.::.:|...|  |..:..:|...
  Fly   140 TQP----IPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHREC--KALLSNDEDCD 198

  Fly   225 AGNL--NNTMDENPCAGDTGSPLIFNETVFGVVSYRVGCGSKTLPSIYTNVYMHMDWINGIMNNN 287
            .|::  .:.:.|..|.||:|.||:.|..:.|:|::...|.: .:|.::.:||.:.|||..:|:.|
  Fly   199 VGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCAT-GVPDVHASVYFYRDWIRNVMSGN 262

  Fly   288  287
              Fly   263  262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 65/235 (28%)
Tryp_SPc 60..280 CDD:214473 63/232 (27%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 64/246 (26%)
Tryp_SPc 38..258 CDD:238113 66/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.