DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG31205

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:290 Identity:71/290 - (24%)
Similarity:125/290 - (43%) Gaps:42/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SRKIFSFLLFLLLLLPILDAGDPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKLF 73
            |||:.:|||.:..|.|.:.|.. :|........|:.:|.....|.|    ::...:|.....|..
  Fly     3 SRKLLTFLLTITTLHPTIQAAS-VGQECGIFNEKQYNSDNIIAEPT----EHPWVVRIVGVTKDG 62

  Fly    74 GDNHFCGGVIISRTYILTSAHC-AMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVP 137
            .:...|.|::|....::|:||| :.|:.:.::.     ||.|.::  .|...|...:.|...:.|
  Fly    63 SNTLLCTGILIDSRRVVTAAHCVSKDESESIYG-----VVFGDSD--SSNINLVSAVTVHPDYSP 120

  Fly   138 DKFTVFNTNNIALMMLAKKLPLDNPLVGVINLPT-ADPEPG---LNYTVLGWGRIFKGGPLASDI 198
            .||    .|::|::.|.|::...: ||..|.||: ::..||   .|..::..|   ..|| :.|.
  Fly   121 RKF----ENDLAIIELTKEVVFSD-LVQPICLPSVSEMVPGSETSNSKLIVAG---LEGP-SFDR 176

  Fly   199 LHIDVELLPRDI-----------CEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVF 252
            .|...:.|.:.|           |.:|...|.||::|.....:.:..:.....:|:|..|:  :.
  Fly   177 RHSATQRLDKRIKMTYTKIDSKECHEKQARFPEELICGHTERSPLSGSALTEASGTPRQFH--LL 239

  Fly   253 GVVSYRVGCGSKTLP-SIYTNVYMHMDWIN 281
            |:..  .|..|..|. ..|.|:..|:|||:
  Fly   240 GIAV--AGFFSSDLDHQGYLNIRPHLDWIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 57/239 (24%)
Tryp_SPc 60..280 CDD:214473 55/236 (23%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 33/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.