DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and sphinx1

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:282 Identity:64/282 - (22%)
Similarity:108/282 - (38%) Gaps:53/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLLLLPILDAGDPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKLFGDNHFCGGVI 83
            |::.|.:|.....:|..  .:.:.|::..|..|..|::....:|..:|:.....:|     .|.|
  Fly     3 LVVTLLVLSLTVSVGEK--NKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYG-----AGTI 60

  Fly    84 ISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDKFTVFNTNNI 148
            ||..:|||       .:.::..|.:.|.:|..    :|.:|..:....|:.|   :|...|.:.|
  Fly    61 ISNQWILT-------VKTVLKYSYIEVHLASR----RSYRGFDIIRIYKENF---RFHYDNDHVI 111

  Fly   149 ALMMLAKKLP-------LDNPLVGVINLPTADPE----PGLNYTVLGWGRIFKGGPLASDILHID 202
            ||:    |.|       :|.     :.:|..|..    .|....|.|:|...:...|...:..|:
  Fly   112 ALV----KCPYQKFDRRMDR-----VRVPAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIE 167

  Fly   203 VELLPRDICEKKVHIFKEEMMCAGNLNNTMDE---NPCAGDTGSPLIF---NETVFGVVSYRVGC 261
            ||::....|.|.....|...||      |..|   ..|.||.|..::.   |.|..|::......
  Fly   168 VEVMNNTECAKYYTPLKWYEMC------TSGEGFKGVCEGDIGGAVVTMGPNPTFIGIIWLMPEN 226

  Fly   262 GSKTLPSIYTNVYMHMDWINGI 283
            .|...||::..|..|:.||..:
  Fly   227 CSIGYPSVHIRVSDHIKWIKRV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 56/239 (23%)
Tryp_SPc 60..280 CDD:214473 54/236 (23%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 58/253 (23%)
Tryp_SPc 26..248 CDD:304450 59/255 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436891
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.