DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and spirit

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:253 Identity:66/253 - (26%)
Similarity:112/253 - (44%) Gaps:61/253 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 CGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDKFTVF 143
            |||.:|:..::||:||||    .:.......|.:.|....|...:.:|:.   :.|..||.....
  Fly   163 CGGALIANNFVLTAAHCA----DLGGEPPSQVRLGGDNLTLTEGEDISIR---RVIIHPDYSAST 220

  Fly   144 NTNNIALMML---AK----------KLPLDNPLVGVINLPTADPEPGLNYTVLGWGRIFKGGPLA 195
            ..|:|||:.|   ||          :..:.|.||                |.:|:|:....|..:
  Fly   221 AYNDIALLELETAAKPELKPTCIWTQKEVTNTLV----------------TAIGYGQTSFAGLSS 269

  Fly   196 SDILHIDVELLPRDICEKKVHIFKEEM--------MCAGNLNNTMDENPCAGDTGSPLIFNE--- 249
            :.:|.:.::.:..:.|:.  |..|:::        ||||::  |.:.:.|.||:|.||:..:   
  Fly   270 AQLLKVPLKSVSNEECQH--HYQKDQLAQGVLGTQMCAGDI--TGERDTCQGDSGGPLLMQDGLL 330

  Fly   250 -TVFGVVSYRVGCGSKTLPSIYTNVYMHMDWINGIM-------NNNEANRL-CYSPNY 298
             .|.|:.|...||.|.. ||:||.|...:|||.||:       |..:.|:: .:||.:
  Fly   331 GYVVGITSLGQGCASGP-PSVYTRVSSFVDWIEGIVWPAQQVTNAPQPNQMTSFSPEF 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 60/228 (26%)
Tryp_SPc 60..280 CDD:214473 58/225 (26%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 60/228 (26%)
Tryp_SPc 132..361 CDD:214473 58/225 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.