DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG11664

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:222 Identity:54/222 - (24%)
Similarity:88/222 - (39%) Gaps:35/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLS------LNM 129
            :::|......|.:.|..|:||.|||.....|              ...|..|.|..      ...
  Fly    39 QIYGPQFLAAGSLFSARYVLTVAHCFKKNTK--------------PEELSVRAGYRWIAWEFRGK 89

  Fly   130 EVKKIFVPDKFTVFNTNNIALMMLAKKLPLDNPLVGVINLPTADPEPGLN-----YTVLGWGRIF 189
            :|..:....||:.....|...::..|.....:.::..|.| .:.|...||     ..:.||..:.
  Fly    90 QVAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGL-CSRPLTPLNMFAPPQELAGWNLMH 153

  Fly   190 KGGPLASDILHIDVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFGV 254
            ...||.|    :.|::.|...|.:........::||   :.||.|..|.||:|.|||....|.|:
  Fly   154 IAQPLKS----MSVQVEPEKNCRQWFPQISGGVICA---SATMGEGLCYGDSGDPLISGGEVCGL 211

  Fly   255 -VSYRVGCGSKTLPSIYTNVYMHMDWI 280
             :::| .||.|..|:::|:|:.|..:|
  Fly   212 AIAFR-KCGDKRYPALFTDVHYHRAFI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 54/222 (24%)
Tryp_SPc 60..280 CDD:214473 53/220 (24%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 54/222 (24%)
Tryp_SPc 38..237 CDD:214473 53/220 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.