DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and GZMH

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_219491.1 Gene:GZMH / 2999 HGNCID:4710 Length:246 Species:Homo sapiens


Alignment Length:287 Identity:76/287 - (26%)
Similarity:122/287 - (42%) Gaps:67/287 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FLLLLLPILDAG----DPIGSHFVRRRAKRLSSPY-----FDKEKTLVLAKYVVSIRSRRPHKLF 73
            |||||..:|..|    :.||.|    .||..|.||     |.:||:          |.|      
Human     4 FLLLLAFLLTPGAGTEEIIGGH----EAKPHSRPYMAFVQFLQEKS----------RKR------ 48

  Fly    74 GDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKK----- 133
                 |||:::.:.::||:|||         :...:.|..|..| :|.::.....:.||:     
Human    49 -----CGGILVRKDFVLTAAHC---------QGSSINVTLGAHN-IKEQERTQQFIPVKRPIPHP 98

  Fly   134 IFVPDKFTVFNTNNIALMMLAKKLPLDNPLVGVINLPT--ADPEPGLNYTVLGWGRIFKGGPLAS 196
            .:.|..|    :|:|.|:.|.:|... ...|..:.||:  |..:||...:|.|||.: ....||:
Human    99 AYNPKNF----SNDIMLLQLERKAKW-TTAVRPLRLPSSKAQVKPGQLCSVAGWGYV-SMSTLAT 157

  Fly   197 DILHIDVELLPRDICEKKVH--IFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFGVVSYRV 259
            .:..:.:.:.....||:..|  ..:...:|.|:...|  :....||:|.||:..:...|::||  
Human   158 TLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKT--QTGFKGDSGGPLVCKDVAQGILSY-- 218

  Fly   260 GCGSK--TLPSIYTNVYMHMDWINGIM 284
              |:|  |.|.:|..|...:.||...|
Human   219 --GNKKGTPPGVYIKVSHFLPWIKRTM 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 57/233 (24%)
Tryp_SPc 60..280 CDD:214473 55/230 (24%)
GZMHNP_219491.1 Tryp_SPc 21..242 CDD:238113 68/267 (25%)
Mediates the preference for acidic residues at the P3' and P4' sites 46..48 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.