DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and Elane

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:288 Identity:79/288 - (27%)
Similarity:133/288 - (46%) Gaps:53/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SRKIFSFLLFLLLLLPILDAGDPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKLF 73
            ::.:.|.||.|||:.|.| |.:.:|.    |.|:..:.|            ::||::.|      
  Rat    12 NQTLASMLLALLLVCPAL-ASEIVGG----RPAQPHAWP------------FMVSLQRR------ 53

  Fly    74 GDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFV-- 136
             ..||||..:|:|.:::::|||...:     ..:.:.||.| .:.|:.|:.......|::||.  
  Rat    54 -GGHFCGATLIARNFVMSAAHCVNGR-----NFQSVQVVLG-AHDLRRREPTRQIFSVQRIFENG 111

  Fly   137 --PDKFTVFNTNNIALMMLAKKLPLDNPLVGVINLPTADPEPGLNYT---VLGWGRIFKGGPLAS 196
              |.:.    .|:|.::.|.....: |..|.|..||......| |.|   .:||||:....||.|
  Rat   112 FDPSRL----LNDIVIIQLNGSATI-NANVQVAELPAQGQGVG-NRTPCVAMGWGRLGTNRPLPS 170

  Fly   197 DILHIDVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFGVVSY-RVG 260
            .:..::|.:: .::|.::|::      |  .|........|.||:|.||:.|..|.|:.|: |.|
  Rat   171 VLQELNVTVV-TNLCRRRVNV------C--TLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGG 226

  Fly   261 CGSKTLPSIYTNVYMHMDWINGIMNNNE 288
            |||...|..:..|....||||.|:.:::
  Rat   227 CGSGFYPDAFAPVAEFADWINSIIRSHD 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 65/230 (28%)
Tryp_SPc 60..280 CDD:214473 62/227 (27%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 66/257 (26%)
Tryp_SPc 33..249 CDD:238113 69/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.