DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and Mcpt2

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:285 Identity:75/285 - (26%)
Similarity:127/285 - (44%) Gaps:55/285 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLFLLLLLPILDAG--DPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKLF----- 73
            ||||:.||....||  :.||.                          |.||...||:...     
  Rat     4 LLFLMALLLPSGAGAEEIIGG--------------------------VESIPHSRPYMAHLDIVT 42

  Fly    74 --GDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFV 136
              |....|||.:|||.::||:|||         :.|.:.|:.| .:.::.|:.....::|:|..:
  Rat    43 EKGLRVICGGFLISRQFVLTAAHC---------KGREITVILG-AHDVRKRESTQQKIKVEKQII 97

  Fly   137 PDKF-TVFNTNNIALMMLAKKLPLDNPLVGVINLPTADP--EPGLNYTVLGWGRIFKGGPLASDI 198
            .:.: :|.|.::|.|:.|.||:.| .|.|.|:.||:...  .||......|||:.....|.:..:
  Rat    98 HESYNSVPNLHDIMLLKLEKKVEL-TPAVNVVPLPSPSDFIHPGAMCWAAGWGKTGVRDPTSYTL 161

  Fly   199 LHIDVELLPRDIC-EKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFGVVSYRVGCG 262
            ..:::.::....| :.:.:.:|.: :|.|  :.|.......||:|.||:......|:|||  |..
  Rat   162 REVELRIMDEKACVDYRYYEYKFQ-VCVG--SPTTLRAAFMGDSGGPLLCAGVAHGIVSY--GHP 221

  Fly   263 SKTLPSIYTNVYMHMDWINGIMNNN 287
            ....|:|:|.|..::.|||.::|.:
  Rat   222 DAKPPAIFTRVSTYVPWINAVINTS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 64/233 (27%)
Tryp_SPc 60..280 CDD:214473 61/230 (27%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 63/260 (24%)
Tryp_SPc 21..242 CDD:238113 66/262 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.