DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and Sp212

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:275 Identity:60/275 - (21%)
Similarity:112/275 - (40%) Gaps:68/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAM 97
            |:.|.|.:...||:.|..:.:.|...                    |.|.:||.:.::::|||  
  Fly   280 GNEFPRGQYPWLSAVYHKEVRALAFK--------------------CRGSLISSSIVISAAHC-- 322

  Fly    98 DKRKIVHR---SRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDKFTVFNTN-----NIALMMLA 154
                 |||   .||:|.:...........|..:...::.::.||    :||.     :|||:.:.
  Fly   323 -----VHRMTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPD----YNTRSYSDADIALITIE 378

  Fly   155 KKLPLDNPLVGVINLPTADPEPGLNYT--VLGWGRIFKGGPLASDILH------IDVELLPRDIC 211
            :.:.. |.::..|.:.|.:....::.|  :.||||       ..|...      ::.|:....:|
  Fly   379 RPVTF-NDIIAPICMWTVEASRTVSTTGFIAGWGR-------DEDSSRTQYPRVVEAEIASPTVC 435

  Fly   212 EK--KVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNE----TVFGVVS--YRVGCGSKTLPS 268
            ..  :..:..|..:||||.:.:   .||.||:|..|:..:    .:.|:||  .|...|:..|..
  Fly   436 ASTWRGTMVTERSLCAGNRDGS---GPCVGDSGGGLMVKQGDRWLLRGIVSAGERGPAGTCQLNQ 497

  Fly   269 --IYTNVYMHMDWIN 281
              :|.::..|::||:
  Fly   498 YVLYCDLSKHINWIS 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 53/248 (21%)
Tryp_SPc 60..280 CDD:214473 51/245 (21%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 60/275 (22%)
Tryp_SPc 277..511 CDD:214473 58/272 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468798
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.