DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and Klk1c2

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:291 Identity:74/291 - (25%)
Similarity:122/291 - (41%) Gaps:56/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLFLLLLLPILDAGDPIGSHFV-RRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKLFGDNHFC 79
            :|.|:|.:..:||..|..|..| ..:.::.|.|:    :..|:.:|:                 |
  Rat     5 ILSLVLSVGRIDAAPPGQSRIVGGYKCEKNSQPW----QVAVINEYL-----------------C 48

  Fly    80 GGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDKFTVFN 144
            |||:|..::::|:|||..:..:         |:.|..|..|........:..:....||...:..
  Rat    49 GGVLIDPSWVITAAHCYSNNYQ---------VLLGRNNLFKDEPFAQRRLVRQSFRHPDYIPLIV 104

  Fly   145 TNNIA---------LMMLAKKLPLDNPLVG---VINLPTADPEPGLNYTVLGWGRIFKGGPLAS- 196
            ||:..         ||:|....|.|  :.|   ||:|||.:|:.|......|||.......:.| 
  Rat   105 TNDTEQPVHDHSNDLMLLHLSEPAD--ITGGVKVIDLPTKEPKVGSTCLASGWGSTNPSEMVVSH 167

  Fly   197 DILHIDVELLPRDICEKKVHIFKEE----MMCAGNLNNTMDENPCAGDTGSPLIFNETVFGVVS- 256
            |:..:::.||..:.|   :..:|:.    |:|||.:....|  .||||:|.|||.:..:.|:.| 
  Rat   168 DLQCVNIHLLSNEKC---IETYKDNVTDVMLCAGEMEGGKD--TCAGDSGGPLICDGVLQGITSG 227

  Fly   257 YRVGCGSKTLPSIYTNVYMHMDWINGIMNNN 287
            ....|.....|:||..:.....||..:|..|
  Rat   228 GATPCAKPKTPAIYAKLIKFTSWIKKVMKEN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 61/240 (25%)
Tryp_SPc 60..280 CDD:214473 59/237 (25%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 63/263 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.