DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG30323

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:304 Identity:82/304 - (26%)
Similarity:124/304 - (40%) Gaps:65/304 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FLLLLLPILDAGDPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKLFGDNHFCGGV 82
            ||||||....|....|...::|.. .::..|...         |||||:|:..:.:||||||.|.
  Fly     3 FLLLLLLTSSAYSNEGKKGLQRNL-YVTDNYHQN---------VVSIRTRKHIRHWGDNHFCAGS 57

  Fly    83 IISRTYILTSAHCAMDKRKIV-----HRSRVLVVVAGTTNRLK--SRKGLSLNMEVKKIFVPDKF 140
            ::|..:::||..|...:.:..     :|..:.|||. |..|||  |.|.:   ..|:|| |.|:.
  Fly    58 LLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVF-TPKRLKKPSPKNI---YHVQKI-VLDES 117

  Fly   141 TVFNTNNIALMMLAKKLPLDNPLVGVINLPTADPEPGLNYT----VLGWGRI------------- 188
            .:.....:||      |.||..:.|. ......||..||.|    .||||||             
  Fly   118 AISGCTELAL------LKLDRGVTGQ-RFAMMLPEKELNSTWLCNSLGWGRIYYVSYVYISAMCP 175

  Fly   189 ------------FKGGPLASDILHIDVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDT 241
                        |:.||.:|:::.|..:.:....|:      .:...|....:.|...|.|..|.
  Fly   176 AFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECK------PDCSRCLCMTSYTGRGNMCQQDL 234

  Fly   242 GSPLIFNETVFGVVSYRVGCGSKTLPSIYTNVYMHMDWINGIMN 285
            ||||..:..::||......|..:.. ..|||:|.:..:|...::
  Fly   235 GSPLFCDHFLYGVARRVHTCDDEGF-MFYTNIYQNRKFIEDTLS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 72/258 (28%)
Tryp_SPc 60..280 CDD:214473 71/255 (28%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 66/248 (27%)
Tryp_SPc 45..272 CDD:214473 65/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436945
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008551
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.