DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG30091

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:311 Identity:75/311 - (24%)
Similarity:130/311 - (41%) Gaps:67/311 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LDAGDPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKLFGDNHFCGGVIISRTYIL 90
            :|||:             |.:|:....||                   .|...|||.:|:..::|
  Fly    41 VDAGE-------------LKNPWMALIKT-------------------NDEFICGGSVITNKFVL 73

  Fly    91 TSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLN--MEVKKIFVPDKFTVFN-TNNIALMM 152
            |:|||.....:.:.:...|.|..|..:.|.:.:....:  ..|:::::.|.|.:.| .|:|||:.
  Fly    74 TAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLR 138

  Fly   153 LAKKL---PLDNPLVGVINLPTADPEPGL--NYTVLGWGRIFKGGPLASDILHIDVELLPRDICE 212
            |.|.:   |...||..::| ....|:..|  .:|.:||| :...|.:::::..:.:..:.|.:||
  Fly   139 LQKSIVYKPQIKPLCILLN-DQLKPQTDLIQEFTAIGWG-VTGNGKMSNNLQMVKIYRIDRKMCE 201

  Fly   213 KKV-HIFKEEMMCAGNLNNTMDENPCAGDTGSPL--------IFNETVFGVVSYRV----GCGSK 264
            ... :.|...|.|||   ..:..:.|..|:|.||        |...|..|:||...    |.|  
  Fly   202 AAFWYTFDYPMFCAG---TAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGFG-- 261

  Fly   265 TLPSIYTNVYMHMDWINGIMNNNEANRLCYSPNYLFTTIGIIIGNKILKSW 315
                :||:|..|:|:|..|:.:.:...:.   .|:.......:||..|.||
  Fly   262 ----MYTDVMGHIDFIERIVLDADIEVVL---PYIDLLDAGCLGNDTLNSW 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 61/243 (25%)
Tryp_SPc 60..280 CDD:214473 60/240 (25%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 67/274 (24%)
Tryp_SPc 37..276 CDD:238113 68/277 (25%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.