DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG30087

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:245 Identity:66/245 - (26%)
Similarity:102/245 - (41%) Gaps:44/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IRSRRPHKLFGDNH---FCGGVIISRTYILTSAHCAMDKRKI---VHRSRVLVVVAGTTNRLKSR 122
            ||| .|..::..|:   .|||.|::..||||:|||.....::   .|..|......|:....:|.
  Fly    50 IRS-APFMVYVTNNSLTHCGGSILNSRYILTAAHCVFPNLRLRLGEHNIRTDPDCQGSNCSPRSE 113

  Fly   123 KGLSLNMEVKKIFVPDKFTVFN-TNNIALMMLAKKLPLD---NPLVGVINLPTADPEPGLNYTVL 183
            :     ..:.|......:...| .|:|||:.|.:.:..:   .|:..::| |.:.|... .|...
  Fly   114 E-----YGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPICILLN-PASAPSVA-TYQTF 171

  Fly   184 GWGRIFKGGPLASDILHI--DVELLPRD--ICEKKVHIFKE-EMMCAGNLNNTMDENPCAGDTGS 243
            |||...|.|     ..|:  ..||...|  .|.:..|.:.. ..:|||:    .:.:.||||:|.
  Fly   172 GWGETKKNG-----FPHLLQTAELRAYDAAYCSRSFHAYMNGNQICAGH----EERDTCAGDSGG 227

  Fly   244 PLIFNETV--------FGVVSY-RVGCGSKTLPSIYTNVYMHMDWINGIM 284
            ||:.....        .|:||| ...|.|   |.:||.|..:::||...|
  Fly   228 PLVTRVDFDGVKRYLQLGIVSYGPTDCQS---PGVYTYVPNYINWIRRAM 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 65/242 (27%)
Tryp_SPc 60..280 CDD:214473 63/239 (26%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 63/239 (26%)
Tryp_SPc 42..272 CDD:238113 65/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437328
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.