DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG30083

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:314 Identity:72/314 - (22%)
Similarity:124/314 - (39%) Gaps:92/314 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IFSFLLFLLLLL----------PILDAGDPIGSHFVR--RRAKRLSSP-------YFDKEKTLVL 57
            :|.|.:|.::||          |  :.|.|..|..:.  :.|:..::|       |.|||    :
  Fly     1 MFIFTIFKIILLWPGAMSQFLEP--NCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKE----V 59

  Fly    58 AKYVVSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSR 122
            |:.|                 |||.:|.:.::|::|||       :.|.::|.|..|       .
  Fly    60 AELV-----------------CGGTLIHKQFVLSAAHC-------IKRDQILAVRLG-------E 93

  Fly   123 KGLSLNMEVKKIFVPDKFTVFN-TNNIALMMLAKKLPLDNPLVG---------VINLPTADPEPG 177
            ...|....|.|.|....||..: :|:|.::.:       .|:|.         :|..||..|.. 
  Fly    94 HSSSRYFAVTKAFRNKYFTTGSYSNDIGILRI-------QPIVKFNAVIRPICIITDPTKVPNV- 150

  Fly   178 LNYTVLGWGRIFKGGPLASDILHIDVELLPRDICEKKVHI-FKEEMMCAGNLNNTMDENPCAGDT 241
            ..:...|||:. :....:..:..:::..|....|...:.: ..|..:|||:    .|.:.||||:
  Fly   151 KTFKAAGWGKT-ENETFSKVLKTVELNELNASECYNMLWVNVTESQICAGH----PDGDTCAGDS 210

  Fly   242 GSPLI--------FNETVFGVVSYRVG-CGSKTLPSIYTNVYMHMDWINGIMNN 286
            |.|||        ......|::|:... |.|   |.:||.:...:|||..:::|
  Fly   211 GGPLIHPVYMDGSLRYVQLGIISFGSSLCNS---PGVYTRLSSFIDWILMVVDN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 55/242 (23%)
Tryp_SPc 60..280 CDD:214473 53/239 (22%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 60/272 (22%)
Tryp_SPc 34..255 CDD:238113 60/271 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437274
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.