DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and Gzmn

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_694692.1 Gene:Gzmn / 245839 MGIID:2675494 Length:248 Species:Mus musculus


Alignment Length:279 Identity:82/279 - (29%)
Similarity:124/279 - (44%) Gaps:54/279 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLFLLLLLPILD-AGDPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKLFGDNHFC 79
            |:.|:.|||:.| |.:.||.|.|    |..|.||      :.|..::         |:.|....|
Mouse     5 LILLIFLLPVGDGAEEVIGGHEV----KPHSRPY------MALVVFL---------KVNGIGSSC 50

  Fly    80 GGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFV-PDKFTVF 143
            ||.::...::||:|||.         ...:.|..|..| |::::.....:.|.|... ||...:.
Mouse    51 GGFLVQDYFVLTAAHCI---------GSSMTVTLGAHN-LRAQEETQQIIPVNKALPHPDYNPLD 105

  Fly   144 NTNNIALMMLAKKL-------PLDNPLVGVINLPTADPEPGLNYTVLGWGRIFKGGPLASDILHI 201
            :||:|.|:.|..|.       ||..|  |    |.....||...:|.|||:........|.:|. 
Mouse   106 HTNDIMLLKLESKAKGTRDVRPLKLP--G----PKDKVNPGDVCSVAGWGKTSINTTEGSALLE- 163

  Fly   202 DVELLPRD--ICEKKV-HIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFGVVSYRVGCGS 263
            :.||:.::  .|:|:. |..|...:|||:.|..  |.|..||:|.||:.|....||:||   ..|
Mouse   164 EAELIIQENKECKKQFRHYSKITEICAGDPNKI--EAPSKGDSGGPLVCNNKAHGVLSY---VKS 223

  Fly   264 KTLPS-IYTNVYMHMDWIN 281
            |.:.| ::|.|...:.||:
Mouse   224 KKISSGVFTKVVHFLPWIS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 66/234 (28%)
Tryp_SPc 60..280 CDD:214473 64/231 (28%)
GzmnNP_694692.1 Tryp_SPc 20..241 CDD:214473 73/261 (28%)
Tryp_SPc 21..244 CDD:238113 75/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.