DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and PRSS55

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:321 Identity:89/321 - (27%)
Similarity:138/321 - (42%) Gaps:74/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IFSFLLFLLLL--------LPILDAGDPI-----GSHFV--------------------RRRAKR 43
            :||.||.|.|:        .|:.:||..|     |:|..                    |.|..|
Human     3 LFSVLLLLSLVTGTQLGPRTPLPEAGVAILGRARGAHRPQPPHPPSPVSECGDRSIFEGRTRYSR 67

  Fly    44 LSSPYFDKEKTLVLAKYVVSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRV 108
            ::.   ..|..:....:.|||::|       ...||||.|:::.:|||:|||...:......   
Human    68 ITG---GMEAEVGEFPWQVSIQAR-------SEPFCGGSILNKWWILTAAHCLYSEELFPEE--- 119

  Fly   109 LVVVAGTTNRLKSRKGLSLNMEVKK---IFVPDKFTVFN-TNNIALMMLAKKLPLDNPLVGVINL 169
            |.||.| ||.|.|.     :||:|:   |.:...|...| .|:|||::||..:.||:..|.:. |
Human   120 LSVVLG-TNDLTSP-----SMEIKEVASIILHKDFKRANMDNDIALLLLASPIKLDDLKVPIC-L 177

  Fly   170 PTADPEPG----LNYTVLGWGRIFKG--GPLASDILHIDVELLPRDICEKKVHIFKEEMMCAGNL 228
            ||   :||    ....|.|||:....  ..:.:|::...:.::..:.|.|......:.|:|||..
Human   178 PT---QPGPATWRECWVAGWGQTNAADKNSVKTDLMKAPMVIMDWEECSKMFPKLTKNMLCAGYK 239

  Fly   229 NNTMDENPCAGDTGSPLIFNET------VFGVVSYRVGCGSKTLPSIYTNVYMHMDWINGI 283
            |.:.|  .|.||:|.||:....      ..|::|:...||.|..|.|||::..:..||..:
Human   240 NESYD--ACKGDSGGPLVCTPEPGEKWYQVGIISWGKSCGEKNTPGIYTSLVNYNLWIEKV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 73/238 (31%)
Tryp_SPc 60..280 CDD:214473 71/235 (30%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 73/252 (29%)
Tryp_SPc 68..298 CDD:238113 74/254 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.