DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and T22A3.6

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:164 Identity:35/164 - (21%)
Similarity:56/164 - (34%) Gaps:56/164 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 MMLAKKLPLDNPLVGVINLPTADPEPGLNYTVLGWGRIFKGGPLASDILHIDVELLPRDICEKKV 215
            ||::.||.|  .|.|::|:          :....:.|.|     :...:::.:.    |.||.. 
 Worm     1 MMVSWKLCL--ILTGLVNV----------FLTKSFTRTF-----SQKFVNVSIS----DDCETT- 43

  Fly   216 HIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFGVVSYRVGCGSKTLPSIYTNVYMH---- 276
               :|.....|...|...:     |||:          |..:|...||..:.|  |:.:..    
 Worm    44 ---EESERIFGYRTNFYSD-----DTGN----------VFCFRKKDGSIRMSS--TSRFFEDPRF 88

  Fly   277 ------MDWINGIMNNNEANRLCY----SPNYLF 300
                  |||..|..|.:..:|.|.    .||..|
 Worm    89 MCSKGSMDWYRGKKNVDFKDRPCLFWSSIPNSTF 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 28/141 (20%)
Tryp_SPc 60..280 CDD:214473 27/138 (20%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.