DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and try-4

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:262 Identity:60/262 - (22%)
Similarity:106/262 - (40%) Gaps:79/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GGVIISRTYILTSAH------------C------------------AMDKRKIVHRSRVLVVVAG 114
            ||.|||..:|:|:||            |                  ..|.||:.:..   ..:.|
 Worm    73 GGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSIYRSIKFLRDTRKVAYGG---TCIRG 134

  Fly   115 TTNRL----KSRKGLSLNMEVKKIFVPDKFTVFNT---NNIALMMLAKKLPLDNPLVGVINLPTA 172
            .|::.    :.:|...::.:|:.:.|..:|...|.   ::.|::.:.|::.....:     .|..
 Worm   135 HTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVEVEKRIHFSENV-----RPIC 194

  Fly   173 DPEPGLNYT----VLGWGRIF---KGGPLASDI-LHID-------VELLPRDICEKKVHIFKEEM 222
            .|.|.:.||    |.||||.:   :.|||..:| :.||       .:.||.|         .::.
 Worm   195 LPRPNMYYTKSLAVPGWGRSYIFNESGPLIHEIPMRIDRDCKRPWSDRLPAD---------ADDF 250

  Fly   223 MCAGNLN--NTMDENPCAGDTGSPLIFNETVFG------VVSYRV-GCGSKTLPSIYTNVYMHMD 278
            :||.::|  |......|.||:|..|.:.:..:|      :.|:.. ||.|..| :.:|.|.|:::
 Worm   251 ICATSMNVSNYSAPRTCHGDSGGGLEYRDDNYGRAFLIAITSFGTRGCPSNML-ARFTRVDMYLN 314

  Fly   279 WI 280
            .|
 Worm   315 LI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 60/262 (23%)
Tryp_SPc 60..280 CDD:214473 59/260 (23%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 60/262 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.