DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG43742

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:257 Identity:70/257 - (27%)
Similarity:114/257 - (44%) Gaps:57/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 FCGGVIISRTYILTSAHCAMDKRKI-VHRSRVLVVVAGTTNR---LKSRKGLSLNMEVKKIFVPD 138
            ||||.:|.:.|:||:|||..|..:: ||        .|..||   :...|.: |.:..|.|..|:
  Fly    57 FCGGSLIHKQYVLTAAHCVRDLDEVTVH--------LGENNRSCPIPVCKHV-LRLNAKVILHPN 112

  Fly   139 KFTVFNTNNIALMMLAKKLPLD---NPLVGVINLPTADPEPGLNYTVLGWGRIFKGGPLASDIL- 199
            .......|:|||:.|.:::..:   .|:..:::......... |:|..|||:...|.  .||:| 
  Fly   113 FHGNIFLNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQN-NFTAYGWGKTEHGN--ISDVLS 174

  Fly   200 HIDVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFN--------ETVFGVVS 256
            .||:..||:.:|.:.::     .:|||:.:.    :.|..|:|.|||.|        :.:||:.|
  Fly   175 FIDLVRLPKSMCYQNIN-----TICAGSTSG----DTCESDSGGPLIGNFVHRGKSRDILFGITS 230

  Fly   257 Y-RVGCGSKTLPSIYTNVYMHMDWINGIMNNNEANRLCYSPNYLFTTIGIIIGNKILKS-WG 316
            | ...|..  |..:||:|..:..||..::..:|...|                |:..|| ||
  Fly   231 YGDAECSG--LFGVYTDVNAYKSWIASVVLESEPRLL----------------NEYCKSDWG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 63/221 (29%)
Tryp_SPc 60..280 CDD:214473 61/218 (28%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 61/218 (28%)
Tryp_SPc 35..256 CDD:238113 63/221 (29%)
Tryp_SPc 273..467 CDD:214473 2/2 (100%)
Tryp_SPc 273..>368 CDD:304450 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.