DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG43336

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:307 Identity:78/307 - (25%)
Similarity:125/307 - (40%) Gaps:77/307 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FLLFLLLLLPILDAGDPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKLF---GDN 76
            |||.||.....||....|.:|          ||...:.|...:|....|     |...|   .|.
  Fly    11 FLLPLLGSTQFLDMACGIRAH----------SPSVPRVKNGTVASLTSS-----PWMAFLHSTDG 60

  Fly    77 HF-CGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLK------SRKGLSLNMEVKKI 134
            .| |||.:|:...:||:|||.:|:.::|.|       .|..:|.:      |.....:...|::.
  Fly    61 RFICGGSLITNRLVLTAAHCFLDRTELVAR-------LGEYDREEYEMCHDSYCTYRIEAMVERG 118

  Fly   135 FVPDKFTVFN----TNNIALMMLAKKLP-LDN--PLVGVIN------LPTADPEPGLNYTVLGWG 186
            |   :...:|    ..:||::.|.:|:. .||  |:..||:      :.:.||..|     .|||
  Fly   119 F---RHRHYNPMTMAYDIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTG-----TGWG 175

  Fly   187 RIFKGGPLASDILHIDVELLPRDICEKKVHI-FKEEMMCAGNLNNTMDENPCAGDTGSPLIFNET 250
            :....|..|. :..:|:.....::|.:...: ......||||..:    |.|.||:|.|      
  Fly   176 KTESEGDSAK-LRTVDLARKHPEVCRRYATLSLTANQFCAGNERS----NLCNGDSGGP------ 229

  Fly   251 VFGVVSY-------RVGCGSKT-----LPSIYTNVYMHMDWINGIMN 285
            |..::.|       :||..|.|     :.|::|:|..::|||..:.|
  Fly   230 VGALIPYGKSKRFVQVGIASFTNTQCVMVSVFTDVMSYVDWILAVHN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 64/258 (25%)
Tryp_SPc 60..280 CDD:214473 62/255 (24%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 64/264 (24%)
Tryp_SPc 40..271 CDD:238113 63/261 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437304
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.