DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG43110

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:267 Identity:70/267 - (26%)
Similarity:101/267 - (37%) Gaps:87/267 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 AKYVVSIRSRRPHKLFGDNH-FCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKS 121
            |:|:..|        |...| .|||.||...::||.|||                        ||
  Fly    47 AQYMAGI--------FNTTHLLCGGTIIHEDFVLTVAHC------------------------KS 79

  Fly   122 RKGLSLNMEVKKIFVP-DKFTVFNT------------NNIALMMLAKKLPLD---NPLVGVINLP 170
            .:.|.:.:....|..| |:..|..|            |:|||:.|.:.:..:   .|:  .|:|.
  Fly    80 TQTLFVRLGAYNINHPTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPI--CIHLD 142

  Fly   171 TADPEPGLNYTVLGWGRIFKGGPLASDIL-HIDVELLPRDICEKKVHIF-----KEEMMCAGNLN 229
            ....:....|...||||.....  .|||| .|.|......||    |::     ..:.:||    
  Fly   143 ATLGKQIRYYNAFGWGRTRNAE--QSDILQRIFVNRTNPMIC----HLYLGMSPDPKQICA---- 197

  Fly   230 NTMDE-NPCAGDTGSPLIFN--------ETVFGVVSYRV----GCGSKTLPSIYTNVYMHMDWIN 281
             |.|: :.||||:|.|||..        :|.||:.||..    |.|      :||:|..:..||.
  Fly   198 -TTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVG------LYTDVSQYSGWIA 255

  Fly   282 GIMNNNE 288
            .|:.:.:
  Fly   256 NIVRSKQ 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 68/258 (26%)
Tryp_SPc 60..280 CDD:214473 66/255 (26%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 67/257 (26%)
Tryp_SPc 36..257 CDD:238113 69/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437382
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.