DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG42694

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:376 Identity:85/376 - (22%)
Similarity:136/376 - (36%) Gaps:130/376 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IFSFLLFLLLL-----LPILD--AGDPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRP 69
            :|::||.|.:|     ...||  .|.||.:..:    .:|..|.         |.::..|.:   
  Fly     4 LFAWLLMLTVLQSHVNSKFLDDYCGAPISNQSI----TKLRQPQ---------AGWLAHISN--- 52

  Fly    70 HKLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKI 134
                |.:..|.|.:||:.::|::|.| :|    ||..  |.|..|.:|..||             
  Fly    53 ----GTHVLCSGSLISKQFVLSAAQC-ID----VHGK--LFVQLGVSNATKS------------- 93

  Fly   135 FVPDKFTVFNT-----------NNIALMMLAKKLPLDN---PLVGVINLPTADPEPGL-NYTVLG 184
              |..:||.|.           .:|.|:.|::.:..::   |:...:|..|.|....| |:|...
  Fly    94 --PHWYTVSNVVIPSHSGKRLQRDIGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSA 156

  Fly   185 WGRIFKGGPLASDILHIDVELLPRDICEKKV--HIFKEEMMCAGNLNNTMDENPCAGDTGSPL-- 245
            |  :.|.....:.:|    ..|.||.|:..:  ::..:| :||.:|..   .|.|..|:||.|  
  Fly   157 W--LSKNKNPQTIVL----SQLSRDRCKLNLSGNVTPKE-ICAASLQR---NNSCFIDSGSALTQ 211

  Fly   246 -------IFNETVFGVVSYRVGCGSKTLPSIYTNVYMHMDWINGIM------------------- 284
                   |..|.:||:..|..|....:.|:||.:|...:.||..::                   
  Fly   212 PIIQGSNIVREMLFGIRGYVNGRSWCSEPAIYIDVAECVGWIETVVQQYDGTDSRAVATPEVNQH 276

  Fly   285 ---------------NNNEANRL-------CYSPNYL----FTTIGIIIGN 309
                           .|...|.|       .|.|||:    |.|...:|.|
  Fly   277 LKHSLSRMGKNILLFKNCRGNSLQSKLRARIYGPNYIGQGWFITHRFVITN 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 61/248 (25%)
Tryp_SPc 60..280 CDD:214473 59/245 (24%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 61/248 (25%)
Tryp_SPc 46..253 CDD:214473 59/245 (24%)
Tryp_SPc 319..505 CDD:304450 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437376
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.