DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6839 and EXOG

DIOPT Version :9

Sequence 1:NP_649076.1 Gene:CG6839 / 40067 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_005098.2 Gene:EXOG / 9941 HGNCID:3347 Length:368 Species:Homo sapiens


Alignment Length:378 Identity:78/378 - (20%)
Similarity:130/378 - (34%) Gaps:131/378 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 SGFNTHSENLLTASCVSGTTFSVGGSNFEFKDLYCKSWPGFKAVKSGATCNG----GIVIRVGFE 163
            |||            |:|......|:.......:...  |.:...:|...:|    .::.:.||.
Human    18 SGF------------VAGAVVGAAGAGLAALQFFRSQ--GAEGALTGKQPDGSAEKAVLEQFGFP 68

  Fly   164 ITSSRFAEQMQICFNEEEEVTRYTRHKLEPGSNYYETGVARITFQTAGFFDGKNVDKLYTQATQ- 227
            :|.:              |...||.|.|.                             |.||.: 
Human    69 LTGT--------------EARCYTNHALS-----------------------------YDQAKRV 90

  Fly   228 ----LETIN-NELGGDAEK-------------YFDSSSNVYL----ARGHLGAKADFDYAPEQRA 270
                ||.|: :::.|||::             .|.:.:..|:    :|||:....:..::.:..|
Human    91 PRWVLEHISKSKIMGDADRKHCKFKPDPNIPPTFSAFNEDYVGSGWSRGHMAPAGNNKFSSKAMA 155

  Fly   271 -TFLFINAAPQWQTFNAGNWARVEDGLR--------AWVSKNKLNVNCYTGVYGVTTLPNK--DG 324
             ||...|..||....|:|.|.|:|...|        .||            |.|..|||..  ||
Human   156 ETFYLSNIVPQDFDNNSGYWNRIEMYCRELTERFEDVWV------------VSGPLTLPQTRGDG 208

  Fly   325 VETPLYLAKDDNNNGLIPVPKLYFRVVIDPSSHRGIV---------FVGVN-----NPHLTEEQI 375
            .:...|....::|   :.||...::|::   :.|..|         ||..|     .|.|||.|:
Human   209 KKIVSYQVIGEDN---VAVPSHLYKVIL---ARRSSVSTEPLALGAFVVPNEAIGFQPQLTEFQV 267

  Fly   376 KRDYVICDDVSDQVTYINW-KTTDIKAGWSY-ACEVADFLKTVKHLPALTAKG 426
            ....:  :.:|..|.:.:. :|:||:...|. .|::.||.:...:|.....:|
Human   268 SLQDL--EKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEG 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6839NP_649076.1 NUC 170..420 CDD:238043 64/299 (21%)
EXOGNP_005098.2 NUC 77..286 CDD:214683 56/257 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.