DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6839 and NUC1

DIOPT Version :9

Sequence 1:NP_649076.1 Gene:CG6839 / 40067 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_012327.1 Gene:NUC1 / 853222 SGDID:S000003744 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:292 Identity:69/292 - (23%)
Similarity:105/292 - (35%) Gaps:90/292 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 NEEEEVTRYTRHKLEPGSNYYETGVARITFQTAGFFDGKNVDKLYTQATQLETINNELGGDAEKY 242
            |.||.::.|.|....|   |:.  :..||.::..   .:|.|:..:...:.|.|..:..|....|
Yeast    73 NREEFISCYNRQTQNP---YWV--LEHITPESLA---ARNADRKNSFFKEDEVIPEKFRGKLRDY 129

  Fly   243 FDSSSNVYLARGHLGAKADFDYAPEQRA---TFLFINAAPQ-WQTFNAGNWARVEDGLRAWVSKN 303
            |.|..:    |||....||..::  |:|   ||...|..|| .:.||...||.:|...|....|.
Yeast   130 FRSGYD----RGHQAPAADAKFS--QQAMDDTFYLSNMCPQVGEGFNRDYWAHLEYFCRGLTKKY 188

  Fly   304 KLNVNCYTGVYGVTTLPNKDGVETPLYLAKDD-------------NNNGLIPVPKLYFRVVI--D 353
            | :|...||               ||||.|.|             .|...|.||..:|::::  .
Yeast   189 K-SVRIVTG---------------PLYLPKKDPIDNKFRVNYEVIGNPPSIAVPTHFFKLIVAEA 237

  Fly   354 PSSHRG------IVFVGVNNP-----HLTEEQIKRDYV-------------------ICDDVSDQ 388
            |:::..      ..||..|.|     .||:.::..|.:                   :|.:|:.|
Yeast   238 PTANPAREDIAVAAFVLPNEPISNETKLTDFEVPIDALERSTGLELLQKVPPSKKKALCKEVNCQ 302

  Fly   389 VTYINWKTTDIKAGWSYACEVADFLKTVKHLP 420
            :...::....||..           |.||.||
Yeast   303 IVVRDFSNAAIKQS-----------KDVKLLP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6839NP_649076.1 NUC 170..420 CDD:238043 67/290 (23%)
NUC1NP_012327.1 NUC1 8..308 CDD:224777 62/264 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.