DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6839 and si:ch211-133n4.4

DIOPT Version :9

Sequence 1:NP_649076.1 Gene:CG6839 / 40067 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001070844.1 Gene:si:ch211-133n4.4 / 559260 ZFINID:ZDB-GENE-030131-898 Length:266 Species:Danio rerio


Alignment Length:175 Identity:50/175 - (28%)
Similarity:70/175 - (40%) Gaps:29/175 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 SSRFAEQMQICFNEEEEVTRY-TRHKLEPGSNYYETGVARITFQTAGFFDGKNVDKLYTQATQLE 229
            |:|:....|...|.....|.| |.:|:...|.|..||....|...:.|                 
Zfish    52 SNRYKLICQQYQNAVRFATLYDTTNKIPTFSAYKYTGKGNFTKPHSRF----------------- 99

  Fly   230 TINNELGGDAEKYFDSSSNVYLARGHL---GAKADFDYAPEQRATFLFINAAPQWQTFNAGNWAR 291
            .|..||..|..|..|..:|:.:.||||   |...|.|.|   ::||...||.||.:|||...|.:
Zfish   100 RIEPELKDDQAKNSDYRNNIQMTRGHLFPSGHAVDLDTA---KSTFTLTNAVPQEKTFNEVTWNQ 161

  Fly   292 VEDGLRAWVSKNKLNVNCYTGVYGVT-TLPN----KDGVETPLYL 331
            .::..:..:..|.:|||.....|.|| .:|.    .|.|..|.::
Zfish   162 KKNNFKTHMDNNCINVNNKVEAYVVTGVIPGDKKLNDKVNIPSHM 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6839NP_649076.1 NUC 170..420 CDD:238043 48/171 (28%)
si:ch211-133n4.4NP_001070844.1 Endonuclease_NS 67..225 CDD:214889 46/160 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto40945
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17361
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.