DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6839 and EndoG

DIOPT Version :9

Sequence 1:NP_649076.1 Gene:CG6839 / 40067 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster


Alignment Length:269 Identity:60/269 - (22%)
Similarity:99/269 - (36%) Gaps:68/269 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 VGFEITSSRFAEQMQICF-------NEEEEVTRYTRHKLEPGSNYYETGVARITFQTAGFFDGKN 217
            |....|.||..:.|:..|       :..:.|..|.|....|...:     ..:|.::....|.  
  Fly    64 VSLTATPSRIGQIMKYGFPGLDHVRSHSDYVLSYDRRNRVPHWVF-----EHLTAESVAKNDA-- 121

  Fly   218 VDKLYTQATQLETINNELGGDAEKYFDSSSNVY----LARGHLGAKADFDYAPEQR---ATFLFI 275
            ||:......|.|:|:        .:|.|.:..|    ..|||:.|..  ::...|:   .||...
  Fly   122 VDRSKCDFKQDESIH--------PFFRSQNTDYRRSGYDRGHMAAAG--NHRLHQKHCDETFYLS 176

  Fly   276 NAAPQ-WQTFNAGNWARVEDGLRAWVSKNKLNVNCYTGVYGVTTLPNKDGVETPLYL--AKDDNN 337
            |.||| .|.||...|..:|..:|. ::|...||...||               ||||  .:||..
  Fly   177 NMAPQVGQGFNRDAWNTLEAHVRR-LTKTYSNVYVCTG---------------PLYLPHKEDDGK 225

  Fly   338 N---------GLIPVPKLYFRVVIDPSSHRGIVFVGVNNPHLTEEQIKRDYVICDDVSDQVTYIN 393
            :         ..:.||..:::|::..|:...:        |: |..:..:.||.:|....|..:.
  Fly   226 SYVKYEVIGANTVAVPTHFYKVIVGESADHKL--------HM-ESYVMPNQVISNDTPISVFQVP 281

  Fly   394 WKTTDIKAG 402
            .::.:..||
  Fly   282 PESVERSAG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6839NP_649076.1 NUC 170..420 CDD:238043 56/259 (22%)
EndoGNP_610737.1 NUC1 39..305 CDD:224777 60/269 (22%)
NUC 77..309 CDD:238043 56/256 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.