DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6839 and Endog

DIOPT Version :9

Sequence 1:NP_649076.1 Gene:CG6839 / 40067 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001030110.1 Gene:Endog / 362100 RGDID:1310763 Length:294 Species:Rattus norvegicus


Alignment Length:151 Identity:43/151 - (28%)
Similarity:58/151 - (38%) Gaps:38/151 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 LETINNE-LGGDAEK-----YFDSSSNVY------------LARGHLGAKADFDYAPEQRA---T 271
            ||.:..| |.||.::     :.|.|.:.|            ..||||.|.|:..::  |||   |
  Rat    93 LEQLRPERLRGDGDRRACDFHEDDSVHAYHRATNADYRGSGFDRGHLAAAANHRWS--QRAMDDT 155

  Fly   272 FLFINAAPQWQTFNAGNWARVEDGLRAWVSKNKLNVNCYTGVY---GVTTLP--NKDGVETPLYL 331
            |...|.|||....|...|..:|...|:.       ...|..||   |...||  ..||.....|.
  Rat   156 FYLSNVAPQVPHLNQHAWNNLEKYSRSL-------TRTYQNVYVCTGPLFLPRTEADGKSYVKYQ 213

  Fly   332 AKDDNNNGLIPVPKLYFRVVI 352
            ....|:   :.||..:|:|:|
  Rat   214 VIGKNH---VAVPTHFFKVLI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6839NP_649076.1 NUC 170..420 CDD:238043 43/151 (28%)
EndogNP_001030110.1 NUC 75..281 CDD:214683 43/151 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.