DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6839 and CG12917

DIOPT Version :9

Sequence 1:NP_649076.1 Gene:CG6839 / 40067 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_610558.2 Gene:CG12917 / 36065 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster


Alignment Length:369 Identity:82/369 - (22%)
Similarity:150/369 - (40%) Gaps:78/369 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 YLKTDSEDFYPFSDVGVMEFESGGSLQLWCPSGFNTHSENLLTASCVSGTTFSVGGSNFEFKDLY 136
            |:...|...:.:.|       :.||:||          :.|.|..  ||.|..|..|...||:..
  Fly    36 YMVEQSNGIFTYRD-------ASGSIQL----------QRLETVP--SGVTLLVYCSPSVFKETV 81

  Fly   137 CKS----------------WPGFKAVKSGATCNGGIVIRVGFEITSSRFAEQMQICFNEEEEVTR 185
            |:.                .|..|.::.| .|.|.: ..||:.| ..:..|..:.||:..:....
  Fly    82 CQDNGQFSVPLPMRCLSPMQPVTKHIRDG-DCAGNL-YAVGYTI-DGKDLELYRTCFDCGQGRLV 143

  Fly   186 YTRHKLEPGSNYYETGVARITFQTAGFFDGKN-----VDKLYTQATQLETINNE-------LGGD 238
            |::..:     ||:|           ||..:.     .|::::.......:.:.       :.||
  Fly   144 YSQSDV-----YYKT-----------FFPKRPFVEFVADEMFSPQEAAAYMKSNIYFAFKCIYGD 192

  Fly   239 AEKYFDSSSNVYLARGHLGAKADFDYAPEQRATFLFINAAPQWQTFNAGNWARVEDGLRAWVSKN 303
            .:.|..:::.:.:.|||:.|.|||.:..:..:||.::|..||:::.|.|||.::|..:|:.:.|:
  Fly   193 DQSYLQNANYLVINRGHMVASADFLFTDQMGSTFRYLNVVPQFKSINDGNWEKIERWVRSQIPKS 257

  Fly   304 KLNVNCYTGVYGVTTLPNKDGVETPLYLAKDDNNNGLIPVPKLYFRVVIDPSSHRGIVFVGVNNP 368
            .. ....:|..|:.|||:..|.....:||     ...||||:..::.|.|.:.:...||:..|:.
  Fly   258 SY-FRVKSGGIGILTLPDTRGFLQSAFLA-----GSKIPVPEWTYKAVRDATGNGLYVFLTYNST 316

  Fly   369 HLTEEQIKRDYVICDDVSDQVTYINWKTTDIKAGWSYACEVADF 412
            ...|:  .....||..|:..:...|    :...|:::.|:...|
  Fly   317 FQMEK--PPCLAICYPVNCPIHLPN----NPNDGYTFCCDPKRF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6839NP_649076.1 NUC 170..420 CDD:238043 57/255 (22%)
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 56/251 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.