DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6839 and Exog

DIOPT Version :9

Sequence 1:NP_649076.1 Gene:CG6839 / 40067 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_006244150.2 Gene:Exog / 301062 RGDID:1304628 Length:443 Species:Rattus norvegicus


Alignment Length:333 Identity:72/333 - (21%)
Similarity:119/333 - (35%) Gaps:115/333 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 CKSWPG----FKAVKSGATCNGGIVI-RVGFEITSSRFAEQMQICFNEEEEVTRYTRHKLEPGSN 196
            |.:.||    ||:|:.       :|: :.||.:|.:              |..|||.|.|.    
  Rat   119 CSTVPGTELAFKSVEK-------VVLEQFGFPLTGT--------------ETRRYTNHALS---- 158

  Fly   197 YYETGVARITFQTAGFFDGKNVDKLYTQATQ-----LETIN-NELGGDAEK-------------Y 242
                                     |.||.:     ||.|: :::.|||::             .
  Rat   159 -------------------------YDQAKRVPRWVLEHISKDKIIGDADRKHCKFKPDPTVPSA 198

  Fly   243 FDSSSNVYL----ARGHLGAKADFDYAPEQRA-TFLFINAAPQWQTFNAGNWARVEDGLR----- 297
            |.:.:..|:    :|||:....:..::.|..| ||...|..||....|:|.|.|:|...|     
  Rat   199 FSALNEDYIGSGWSRGHMAPAGNNKFSSEAMAETFYLSNIVPQNFENNSGYWNRIEMYCRELTER 263

  Fly   298 ---AWVSKNKLNVNCYTGVYGVTTLPN--KDGVETPLYLAKDDNNNGLIPVPKLYFRVVI---DP 354
               .|:            |.|..|||:  .||.:|..|....::|   :.||...::|::   .|
  Rat   264 FEDVWI------------VSGPLTLPHTRNDGTKTVSYQVIGEDN---VAVPSHLYKVILARRSP 313

  Fly   355 SSHRGI---VFVGVNNPHLTEEQIKRDYVICDDVSDQVTYINW----KTTDIKAGWSY-ACEVAD 411
            .|...:   .||..|.....:.|:....|...|:......:.:    :|.||:...|. .|::..
  Rat   314 ESTEPLALGAFVVPNKAIGFQSQLSEFQVSLHDLEKMSGLVFFPHLDRTRDIRNICSVDTCKLLG 378

  Fly   412 FLKTVKHL 419
            |.:...:|
  Rat   379 FQEFTLYL 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6839NP_649076.1 NUC 170..420 CDD:238043 62/295 (21%)
ExogXP_006244150.2 NUC 152..361 CDD:214683 53/252 (21%)
Exog_C 377..425 CDD:407864 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341974
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.