DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6839 and Exog

DIOPT Version :9

Sequence 1:NP_649076.1 Gene:CG6839 / 40067 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_766044.1 Gene:Exog / 208194 MGIID:2143333 Length:368 Species:Mus musculus


Alignment Length:267 Identity:58/267 - (21%)
Similarity:91/267 - (34%) Gaps:108/267 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 GFKAVKSGATCNGGIVIRVGFEITSSRF-----AEQMQICFNEEE-----------------EVT 184
            ||.|        |.:|...|..:|:.:|     ||..::.....|                 |..
Mouse    19 GFLA--------GAVVGAAGAGLTALQFFRRPDAESAKLARQPHESAEEAVLEQFGFPLAGTETR 75

  Fly   185 RYTRHKLEPGSNYYETGVARITFQTAGFFDGKNVDKLYTQATQ-----LETIN-NELGGDAEK-- 241
            |||.|.|.                             |.||.:     ||.|: :::.|||::  
Mouse    76 RYTNHALS-----------------------------YDQAKRVPRWVLEHISKDKIIGDADRKH 111

  Fly   242 -----------YFDSSSNVYL----ARGHLGAKADFDYAPEQRA-TFLFINAAPQWQTFNAGNWA 290
                       .|.:.:..|:    :|||:....:..::.|..| ||...|..||....|:|.|.
Mouse   112 CKFKPDPSVPSAFSALNEDYIGSGWSRGHMAPAGNNKFSSEAMAETFYLSNIVPQNFDNNSGYWN 176

  Fly   291 RVEDGLR--------AWVSKNKLNVNCYTGVYGVTTLPN--KDGVETPLYLAKDDNNNGLIPVPK 345
            |:|...|        .|:            |.|..|||:  .||.:|..|....::|   :.||.
Mouse   177 RIEMYCRELTERFEDVWI------------VSGPLTLPHTRNDGTKTVSYQVIGEDN---VAVPS 226

  Fly   346 LYFRVVI 352
            ..::|::
Mouse   227 HLYKVIL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6839NP_649076.1 NUC 170..420 CDD:238043 50/234 (21%)
ExogNP_766044.1 NUC 77..287 CDD:214683 45/201 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838192
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.